PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G61620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 317aa    MW: 35013.7 Da    PI: 9.8625
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G61620.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.46.7e-13108153247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+eE+  ++ + ++lG+g+W+ Ia+ +  +Rt+ q+ s+ qky
      AT5G61620.1 108 KPWTEEEHRNFLIGLNKLGKGDWRGIAKSFVSTRTPTQVASHAQKY 153
                      58*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.6141225IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.781102158IPR017930Myb domain
SuperFamilySSF466898.61E-17104158IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-16105156IPR006447Myb domain, plants
SMARTSM007173.5E-10106156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-11106152IPR009057Homeodomain-like
PfamPF002492.2E-11108153IPR001005SANT/Myb domain
CDDcd001674.70E-9109154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000084anatomyplant sperm cell
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MVKETVTVAK TCSHCGHNGH NARTCLNGVN KASVKLFGVN ISSDPIRPPE VTALRKSLSL  60
GNLDALLAND ESNGSGDPIA AVDDTGYHSD GQIHSKKGKT AHEKKKGKPW TEEEHRNFLI  120
GLNKLGKGDW RGIAKSFVST RTPTQVASHA QKYFIRLNVN DKRKRRASLF DISLEDQKEK  180
ERNSQDASTK TPPKQPITGI QQPVVQGHTQ TEISNRFQNL SMEYMPIYQP IPPYYNFPPI  240
MYHPNYPMYY ANPQVPVRFV HPSGIPVPRH IPIGLPLSQP SEASNMTNKD GLDLHIGLPP  300
QATGASDLTG HGVIHVK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184244890.0
Genevisible247535_at0.0
Expression AtlasAT5G61620-
AtGenExpressAT5G61620-
ATTED-IIAT5G61620-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G61620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G61620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0122390.0AB012239.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K11J9.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200970.10.0myb-like transcription factor family protein
TrEMBLQ9FKF90.0Q9FKF9_ARATH; Myb-like transcription factor family protein
STRINGAT5G61620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60212747
Representative plantOGRP3941699
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  3. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  6. Ikeda M,Ohme-Takagi M
    A novel group of transcriptional repressors in Arabidopsis.
    Plant Cell Physiol., 2009. 50(5): p. 970-5
    [PMID:19324928]